PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna08084.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 273aa    MW: 30450.8 Da    PI: 4.8416
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna08084.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.6e-181461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd  lv +++q+G g+W++ ++  g+ R++k+c++rw +yl
  mrna08084.1-v1.0-hybrid 14 KGPWTPEEDHVLVSYIQQYGHGNWRALPKLAGLLRCGKSCRLRWTNYL 61
                             79******************************99************97 PP

2Myb_DNA-binding52.21.4e-1667112148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg+++ eE+e +++++++lG++ W++Ia++++ gRt++++k+ w+++l
  mrna08084.1-v1.0-hybrid  67 RGNFSREEEEAIINLHQMLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 112
                              89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-25564IPR009057Homeodomain-like
PROSITE profilePS5129416.849961IPR017930Myb domain
SuperFamilySSF466894.23E-3110108IPR009057Homeodomain-like
SMARTSM007171.1E-121363IPR001005SANT/Myb domain
PfamPF002497.9E-161461IPR001005SANT/Myb domain
CDDcd001671.97E-101661No hitNo description
PROSITE profilePS5129425.72762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2665116IPR009057Homeodomain-like
SMARTSM007179.4E-1566114IPR001005SANT/Myb domain
PfamPF002494.1E-1567112IPR001005SANT/Myb domain
CDDcd001673.01E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MVRAPCCEKM GLKKGPWTPE EDHVLVSYIQ QYGHGNWRAL PKLAGLLRCG KSCRLRWTNY  60
LRPDIKRGNF SREEEEAIIN LHQMLGNRWS AIAARLPGRT DNEIKNVWHT HLKKKLNIKQ  120
SPTTPEALGQ VSEPELPKPE DASCHAKSES FEYGPVSPPQ CTTSSADDTS SFTTSENNNS  180
SSANMGMNVD YEVSLPEADE SFWSEVLSAD HNSPNELVSS HFGDQAIGAA ENPQVNTSMD  240
YGFSGSNMYE NCMDFWYDVF TRAGEIPELL DI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121175109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8285500.0FR828550.1 Rosa rugosa mRNA for putative MYB transcription factor (myb17 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004289939.10.0PREDICTED: myb-related protein Myb4
SwissprotQ7XBH43e-76MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLF2QKX01e-165F2QKX0_R
STRINGPOPTR_0002s03960.12e-98(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.18e-82myb domain protein 14